Open access peer-reviewed chapter

Application of Two-Dimensional Gel Electrophoresis in Combination with Mass Spectrometry in the Study of Hormone Proteoforms

Written By

Xianquan Zhan and Tian Zhou

Submitted: 08 September 2018 Reviewed: 14 November 2018 Published: 19 December 2018

DOI: 10.5772/intechopen.82524

From the Edited Volume

Mass Spectrometry - Future Perceptions and Applications

Edited by Ganesh Shamrao Kamble

Chapter metrics overview

1,100 Chapter Downloads

View Full Metrics

Abstract

Hormone is a category of important endocrine regulatory proteins in human endocrine systems. Clarification of hormone proteoforms directly leads to understanding of its biological roles. Two-dimensional gel electrophoresis (2DGE) in combination with mass spectrometry (MS) plays important roles in identification of hormone proteoforms such as human growth hormone (hGH) proteoforms and human prolactin (hPRL) proteoforms. This book chapter will review the hormone proteoforms focusing on hGH and hPRL, the methodology of hormone proteoform study, and future perspective of human hormone proteoform study to find biomarkers for in-depth understanding of molecular mechanisms, and individualized and precise diagnosis, therapy, and prognostic assessment of hormone-related diseases.

Keywords

  • two-dimensional gel electrophoresis
  • mass spectrometry
  • tandem mass spectrometry
  • liquid chromatography
  • hormone
  • growth hormone
  • prolactin
  • variant
  • proteoform

1. Introduction

Hormone is a category of important endocrine regulatory proteins in the human endocrine systems. Hormone is a chemical message substance synthesized by highly differentiated endocrine cells and directly secreted into the blood, which has high biological activities and transmits information in the body as a messenger. It is a vital substance in human life and plays important roles in regulating physiological processes such as metabolism, growth, and development.

Notably, human growth hormone (hGH) and human prolactin (hPRL) are two key hormones in human body. The hGH, also known as somatotropin, is produced in the acidophilic somatotroph cells of the anterior pituitary gland and is a 191 amino acid single chain polypeptide, which is released into the blood circulation and takes part in the hypothalamic-anterior pituitary-skeletal muscle axis system to regulate growth and development in human body [1, 2]. The synthesis and release of hGHs are affected by multiple complex feedback mechanisms, and the major regulators are growth hormone-releasing hormone (GHRH) synthesized in the hypothalamus, somatostatin derived from various tissues of the body, and ghrelin produced in the gastrointestinal tract. The mechanism of the effect of hGH is to directly bind with target organs for response of stimulation or it is indirectly influenced by the role of insulin-like growth factor-1 (IGF-1). The IGF-1 secreted from hepatocytes responds to the binding of hGH to surface receptors. If the Janus activating tyrosine kinases (JAKs) 1 and 2 are activated and bound to the cytoplasmic transcriptions factors STAT1, STAT3, and STAT5, and transported into the nucleus, thus enhanced gene transcription and metabolism would be induced, and the corresponding IGF-1 is generated and released into circulation. IGF-1 affects the growth and metabolism of peripheral tissues, which is able to understand as a combined impact of IGF-1 and hGH [2, 3]. The deficiency of hGH leads to growth deficit in children and the GH deficiency syndrome in adults, conversely, hGH hypersecretion results in gigantism or acromegaly [4, 5, 6, 7]. It is obvious that hGH plays an important role in regulation of human life activities. In addition, hPRL should be paid more attention to its relevant functional study. The hPRL, a four long α-helix protein hormone, is mainly secreted by lactotrophs in the anterior pituitary gland except placental PRL [8]. The secretion of hPRL is usually regulated by PRL inhibitors such as dopamine from hypothalamus [9]. The hPRL is a polypeptide hormone with a wide variety of functions such as controls osmotic pressure and vascularization, participates in the immune response, and promotes neurogenesis in maternal and fetal brains [10, 11]. Moreover, the hPRL transports to the target organs and tissues via the blood circulation to bind to two different types of long or short hPRL receptors (hPRLRs) to activate signal pathways including JaK2 activation, Ras-Raf-MAPK pathway, modulatory pathways, PI3K and downstream pathways, and Stats [12]. However, hGH and hPRL exist multiple structural and functional formats, namely different proteoforms. The proteoform can clarify the function and effect of specific protein in human body and is an intuitive and visual expression of the gene. Therefore, the clarification of hormone proteoforms is necessary to understand its biological roles. Protein proteoforms are primarily derived from alternative splicing, post-translational modifications (PTMs), translocation, redistribution, and spatial conformation alterations [13]. The protein proteoforms can be identified with two-dimensional gel electrophoresis (2DGE) and mass spectrometry (MS).

The isoelectric point (pI) and relative mass (Mr) are the basic characteristics of a proteoform. 2DGE is depended on different pI and Mr values to separate proteoforms, which first separates proteoforms by different pI values in the isoelectric focusing (IEF) direction, and second separates proteoforms by different Mr values in the sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) direction [14]. 2DGE-based Western blotting coupled with specific antibody can detect a proteoform of a specific protein. Thus, the proteoforms of hGH and hPRL are able to be separated and arrayed with 2DGE. MS is an effect method to characterize protein proteoforms and identify PTMs with an analysis of amino acid sequence and determination of PTM sites [15]. The combination of 2DGE and MS plays an important role in detection, identification, and quantification of proteoforms of hGH and hPRL. The MS methods that were used to study the proteoforms of hGH and hPRL were commonly divided into peptide fingerprint (PMF) and tandem mass spectrometry (MS/MS) analyses. PMF data are commonly obtained with matrix-assisted laser desorption/ionization (MALDI)-time-of-flight (TOF) mass spectromety (MS), and MS/MS data can be obtained from MALDI-TOF-TOF MS or liquid chromatography (LC)-electrospray ionization (ESI)-quadruple-ion trap (Q-IT) MS.

This book chapter will mainly review the hormone proteoforms focusing on hGH and hPRL, the methodology of hormone proteoform study, and future perspective to find effective and potential hormone proteoform biomarkers for in-depth understanding of molecular mechanisms, and individualized and precise diagnosis, therapy, and prognostic assessment of hormone-related diseases.

Advertisement

2. Materials and methods

2.1 Tissues and protein extraction

The human control pituitary tissue samples were post-mortem tissues, and human pituitary adenoma tissue samples were obtained from neurosurgery. The detailed information of those tissue samples were described previously [15, 16]. The collected tissues were immediately frozen in liquid nitrogen, and stored at −80°C until used. The protein extraction of pituitary control and adenoma tissues was performed as described previously [17, 18]. In brief, the contaminated blood in each tissue sample was washed with 0.9% NaCl (3 mL, 5×). The proteins were extracted with protein extraction buffer that consists of 2 mol/L thiourea, 7 mol/L urea, 40 g/L CHAPS, 100 mmol/L dithiothreitol (DTT), 5 mol/L immobilized pH gradient (IPG) buffer pH 3–10 NL, and a trace of bromophenol blue, followed by centrifugation (15,000×g, 15 min, 4°C). The supernatant was collected as protein sample, and its protein concentration was determined with a Bio-Rad 2D Quant kit (Bio-Rad) [15].

2.2 2DGE and 2DGE-based Western blot

Each protein sample was first separated by IEF with pH 3–10 NL IPG strips (180 mm × 3 mm × 0.5 mm), under the IEF condition that was a gradient from 0 to 250 V within 1 h (125 Vh), a gradient from 125 to 1000 V within 1 h (500 Vh), a gradient from 1000 to 8000 V within 1 h (4000 Vh), a step-and-hold at 8000 V for 4 h (32,000 Vh), and a step-and-hold at 500 V for 0.5 h (250 Vh) to achieve a total of 36,875 Vh within ~7.5 h [19]. After IEF, proteins were reduced with DTT, and alkylated with iodoacetamide, and then were separated with the 12% SDS-PAGE resolving gel (250 mm × 215 mm × 1.0 mm) in the Tris-glycine-SDS electrophoresis buffer that contained 192 mmol/L glycine, 25 mmol/L Tris-base, and 1 g/L SDS with an electrophoresis condition (250 V, 360 min, 25°C) [20]. The 2DGE-separated proteins were visualized with silver-staining [21].

After 2DGE, the proteins were transferred onto a polyvinylidene fluoride (PVDF) membrane, blocked with bovine serum albumin (BSA), and incubated with hormone antibodies and secondary antibody. The proteins on the membrane were visualized with 5-bromo-4-chloro-3-indolyl phosphate [15].

The silver-stained 2D gels and 2DE-Western blot images were digitized and analyzed with Discovery Series PDQuest 2D Gel Analysis software [22, 23].

2.3 MS-characterization

2.3.1 MALDI-TOF MS

The tryptic peptide mixture was purified with ZipTipC18, and analyzed with a Perspective Biosystems MALDI-TOF Voyager DE-RP MS (Framingham, MA, USA). The PMF data were obtained to search Swiss-Prot database with PeptIdent software for protein identification. The detailed procedure was described previously [22].

2.3.2 LC-ESI-Q-IT MS

The tryptic peptide mixture was purified with ZipTipC18, and analyzed with LC-ESI-Q-IT MS on an LCQDeca mass spectrometer (Thermo Finnigan, San Jose, CA, USA). The MS/MS data were obtained to search Swiss-Prot database for protein identification. The detailed procedure was described previously [22].

2.3.3 MALDI-TOF-TOF MS

The tryptic peptide mixture was purified with ZipTipC18, and analyzed with MALDI-TOF-TOF MS on Perspective Biosystems UltraFlex III MALDI-TOF-TOF (Bruker Daltonics). The MS and MS/MS data were obtained to search Swiss-Prot database for protein identification. The detailed procedure was described previously [15].

2.4 Bioinformatics

Many phosphorylation sites of hGH proteoforms were identified with MS/MS, and deamidation was found in many hGH proteoforms. The PTM sites of hPRL in human pituitary adenoma and control tissues, including phosphorylation sites, N-glycosylation sites, and O-glycosylation sites were predicted with NetPhos 3.1 Server (http://www.cbs.dtu.dk/services/NetPhos) [24, 25], NetNGlyc 1.0 Server (http://www.cbs.dtu.dk/services/NetNGlyc) [26], and NetOGlyc 4.0 Server (http://www.cbs.dtu.dk/services/NetOGlyc) [27], respectively.

Advertisement

3. Results and discussion

3.1 MS-identification of open reading frames (ORFs) of hGH and hPRL proteoforms within 2DGE pattern, and confirmed with Western blot

Over 1000 protein spots were found in each pituitary 2D gel (n = 30). MS is an effective method to identify ORFs of a gene across 2DGE map, generally cannot identify proteoforms with the common procedure because MS only detects a partial amino acid sequence but not its complete sequence of a protein. However, each proteoform has its specific pI and Mr, which can be separated with 2DGE. 2DGE coupled with MS can effectively array and identify proteoforms that are derived from the same gene. Thus, 24 hGH proteoforms (Figure 1A) [1] and 6 hPRL proteoforms (Figure 1B) [15] were MS-characterized within pituitary 2DGE map.

Figure 1.

2DGE patterns of hGH proteoforms (A) and hPRL proteoforms (B) in human pituitaries. The total proteins extracted from pituitary tissues were separated with IPG strip pH 3–10 NL and 12% SDS-PAGE gel, and stained with silver-staining. Modified from Zhan et al. [1], with permission from Wiley-VCH, copyright 2005; and from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018.

Some hGH proteoforms and hPRL proteoforms within 2DGE map (Figure 1) were also validated with Western immunoblot. For example, four hPRL proteoforms were confirmed with 2DGE-Western blot (Figure 2). It demonstrated that 2DGE-MS was an effective and reliable approach to detect and identify proteoforms derived from hGH and hPRL genes. The other hGH proteoforms and hPRL proteoforms were not be validated with immnuoblot, which might be due to no-reactivity of antibody to a specific proteoform.

Figure 2.

hPRL proteoforms were validated with 2DGE-Western blot analysis. (A) Western blot image of hPRL proteoforms (rabbit anti-hPRL antibodies + goat anti-rabbit alkaline phosphatase-conjugated IgG). (B) Silver-stained image on a 2D gel after proteins were transferred to a PVDF membrane. Reproduced from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018.

The hGH proteoforms or hPRL proteoforms in each 2D spot were identified with MS including PMF and MS/MS. For example, the protein in spot 6 in Figure 1A was identified as hGH isoform 1 (P01241) with MALDI-TOF PMF data (Figure 3). The protein in spot v6 in Figure 1B was identified as hPRL (P01236) with MALDI-TOF-TOF PMF data (Figure 4), and MS/MS data (Figure 5).

Figure 3.

MALDI-TOF MS spectrum of hGH isoform 1 (spot 6). T = autodigested fragments of trypsin. M* = oxidized Met. C# = carbamidomethyl-Cys. N@ = deamidated Asn. Reproduced from Zhan et al. [1], with permission from Wiley-VCH, copyright 2005.

Figure 4.

MALDI-TOT-TOF MS spectrum of hPRL (spot v6). Reproduced from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018.

Figure 5.

MALDI-TOF-TOF MS/MS spectrum of the tryptic peptide 118SWNEPLYHLVTEVR131 from hPRL in spot v6. Reproduced from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018.

Therefore, 2DGE-MS clearly identified 24 hGH proteoforms and 6 hPRL proteoforms with different pI-Mr distributions on a 2DGE pattern. Furthermore, one investigated the reasons to form those hormone proteoforms, including signal peptide, splicing variation, and PTMs such as deamination, phosphorylation, and glycosylation.

3.2 MS-determination of signal peptide contained in each hGH or hPRL proteoform in human pituitaries

If signal peptide is contained in the sequence of hGH or hPRL, then it means that hormone is a prohormone (Figure 6). It is necessary to determine whether signal peptide is contained in each hGH proteoform or hPRL proteoform. MS can identify the characteristic tryptic peptide sequences before and after removal of signal peptide in hGH or hPRL (Table 1). For 24 hGH proteoforms in human pituitaries, checking all MS data of those 24 hGH proteoforms, the tryptic peptide sequence FPTIPLSR (position 27–34) (Figure 3) was detected for each hGH proteoform, but no any characteristic tryptic peptide sequence before removal of signal peptide was found (Table 1). It clearly demonstrated that no signal peptide sequence was contained in those 24 hGH proteoforms in the 2DGE pattern (Figure 1A). For 6 hPRL proteoforms in human pituitaries, checking all MS data of those 6 hPRL proteoforms, the tryptic peptide sequence MNIKGSPWK (position 1–9) (Figure 4) was detected for each hPRL proteoform, but no any characteristic tryptic peptide sequence after removal of signal peptide was found (Table 1). It clearly demonstrated that signal peptide sequence was contained in those 6 hPRL proteoforms in the 2DGE pattern (Figure 1B).

Figure 6.

The amino acid sequences of hGH and hPRL prohormones. Modified from Zhan et al. [1], with permission from Wiley-VCH, copyright 2005; and from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018.

Hormone Before and after removal of signal peptide Position Characteristic tryptic peptide sequence Calc. [M + H]+ Observed [M + H]+
hGH
(signal peptide sequence 1–26)
Before 1–6 MATGSR 622.3 (MSO: 1; 638.3)
7–34 TSLLLAFGLLCLPWLQEGSAFPTIPLSR 3043.7
3100.7(Cys_CAM: 17)

1–34 MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSR 3646.9
3704.0 (Cys_CAM: 17)
3662.9 (MSO: 1)


7–42 TSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLR 4004.2
4061.2 (Cys_CAM: 17)
4020.1 (MSO: 40)


After 27–34 FPTIPLSR 930.5 +
27–42 FPTIPLSRLFDNAMLR 1891.0
1907.0 (MSO: 40)
±
hPRL
(signal peptide sequence 1–28)
Before 1–4 MNIK 505.2803
1–9 MNIKGSPWK 1060.5608 +
1–38 MNIKGSPWKGSLLLLLVSNL LLCQSVAPLPICPGGAAR 3930.1893
5–9 GSPWK 574.2983
5–38 GSPWKGSLLLLLVSNLLLCQ SVAPLPICPGGAAR 3443.9268
10–38 GSLLLLLVSNLLLCQSVAPL PICPGGAAR 2888.6463
10–44 GSLLLLLVSNLLLCQSVAPL PICPGGAARCQVTLR 3589.0154
After 29–38 LPICPGGAAR 954.5189
29–44 LPICPGGAARCQVTLR 1654.8879
29–49 LPICPGGAARCQVTLRDLFD R 2301.1954

Table 1.

Characteristic tryptic peptides before or after removal of signal peptide sequence in hGH or in hPRL.

Modified from Zhan et al. [1], with permission from Wiley-VCH, copyright 2005; and from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018. Note: +: this peptide ion was observed in each MS spectrum. −: this peptide ion was not observed by MS. ±: tryptic peptide ion was detected in some but not all PMF data from 24 hGH proteoforms.

3.3 MS-identification of splicing variants of hGH in human pituitaries

MS is an effective method to identify splicing variants of hGH. hGH splicing variant 2 is derived from deletion of positions 58–72 from hGH, hGH splicing variant 3 is derived from deletion of positions 111-148 from hGH, and hGH splicing variant 4 is derived from deletion of positions 117-162 from hGH (Figure 6). The characteristic tryptic peptides for each hGH splicing variant can be theoretically obtained and observed by MS (Table 2). The MS data of 24 hGH proteoforms were checked one-by-one. The results showed that hGH splicing variant 2 existed in spot 9, hGH splicing variant 3 existed in spots 2 and 23, and hGH splicing variant 4 existed in spot 13. hGH variant 1 existed in the rest 20 spots.

GH variants Tryptic peptide that covers the splicing site Calculated [M + H] + ion (m/z) Observed [M + H]+ ion (m/z) in PMF data hGH proteoforms (Spot No.)
1 142DLEEGIQTLMGR153 1361.7
1377.7 (MSO: 151)
One or two ions were detected to exclude splicing variants 3 and 4
One, two or three ions were detected to exclude splicing variant 2
1; 3–8; 10–12; 14–22; 24
121SVFANSLVYGASDSNVYDLLK141 2262.1
46LHQLA FDTYQEFEEAYIPK64 2342.1
68YSF LQNPQTSLCFSESIPTPSNR90 2616.2
2673.2 (Cys-CAM: 79)
43AHRLHQLAFDTYQ EFEEAYIPK64 2706.3
2 LHQLAFDTYQEF58NPQTSLCFSESIPTPSNR 3470.6
3527.7 (Cys-CAM: 64)

3527.4
9
AHRLHQLAFDTYQEF58NPQTSLCFSESIPTPSNR 3834.8
3891.9 (Cys-CAM: 64)

LHQLAFDTYQEF58NPQTSLCFSESIPTPSNREETQQK 4213.9
4271.0 (Cys-CAM: 64)

3 ISLLLIQ111TLMGR 1357.8
1373.8 (MSO: 113)
1357.7
2; 23
ISLLLIQ111TLMGRLEDGSPR 2112.2
2128.2 (MSO: 113)

SNLE LLRISLLLIQ111TLMGR 2183.3
2199.3 (MSO: 113)

4 ISLLLIQSWLEPV117QIFK 2027.2 2027.0 13
ISLLLIQSWLEPV117QIFKQTYS K 2634.5
SNLE LLRISLLLIQSWLEPV117QIFK 2852.7

Table 2.

Determination of the hGH splicing variants.

Modified from Zhan et al. [1], with permission from Wiley-VCH, copyright 2005.

However, hPRL does not have splicing variants. The Mr of hPRL proteoforms was 26.0 kDa for v1, 26.1 kDa for v4, 25.9 kDa for v5, and 25.9 kDa for v6 in 2DGE pattern (Figure 1), which was almost equal to the Mr (25.9 kDa) of hPRL prohormone. Moreover, the Mr of hPRL proteoforms was 26.4 kDa for v2, and 27.9 kDa for v3, which is slightly greater than Mr (25.9 kDa) of hPRL prohormone. These data further confirmed that those six hPRL proteoforms were not generated from mature hPRL (position 29–227) but from hPRL prohormone (positions 1–227) in human pituitary tissues. These data coupled with MS data clearly demonstrated six hPRL proteoforms were not derived from splicing.

3.4 MS/MS-identification of PTMs in hormone proteoforms

MS/MS was an effective method to identify the PTMs and their modification sites of hGH and hPRL to clarify the reasons of formation of hGH proteoforms and hPRL proteoforms. MS/MS identified phosphorylation at sites Ser-77, Ser-132, and Ser-176 in many hGH proteoforms (Table 3). A representative MS/MS spectrum was shown to determine phosphorylation site Ser-77 in hGH proteoform 6 (Spot 6) (Figure 7). Also, deamidation was found in many hGH proteoforms. In addition, there would be other PTMs in hGH proteoforms that need to be further characterized.

hGH proteoforms (Spot No.) Splicing variants Phosphorylation (p) Deamidation (d)
1 1/2 pSer176
2 3; 1/2
3 1 pSer132
4 1
5 1 pSer176; dAsn178
6 1 pSer77, pSer132, pSer176 dAsn178
7 1
8 1 pSer176, pSer132
9 2 pSer176
10 1 pSer176
11 1 pSer77, pSer132
12 1 pSer176; pSer132
13 4; 3
14 1 pSer132
15 1 pSer176, pSer132
16 1 pSer176 dAsn178
17 1
18 1 pSer176, pSer132
19 1
20 1
21 1
22 1
23 3; 1
24 1 pSer132

Table 3.

PTMs were identified in hGH proteoforms.

Modified from Zhan et al. [1], with permission from Wiley-VCH, copyright 2005.

Figure 7.

MS2 spectrum of a phosphopeptide ([M + 3H]3+: m/z = 899.47; retention time = 51.44 min; scan number 2167) derived from hGH proteoform 6 (Spot 6). Reproduced from Zhan et al. [1], with permission from Wiley-VCH, copyright 2005.

For hPRL proteoforms, bioinformatics including NetPhos 3.1 Server (http://www.cbs.dtu.dk/services/NetPhos) [24, 25] predicted 14 pS sites, 5 pT sites, and 3 pY sites in the hPRL (Table 4), NetNGlyc 1.0 Server (http://www.cbs.dtu.dk/services/NetNGlyc) [26] predicted ten significantly N-glycosylated sites (Table 5), and NetOGlyc 4.0 Server (http://www.cbs.dtu.dk/services/NetOGlyc) [27] predicted six significantly O-glycosylated sites in the hPRL (Table 6) in human pituitaries. These predicted PTM sites in hPRL proteoforms provided clues and needed to be confirmed with MS/MS in future studies.

Sequence # x Context Score* Kinase Answer
Sequence 6 S NIKGSPWKG 0.779 unsp YES
Sequence 11 S PWKGSLLLL 0.848 PKA YES
Sequence 18 S LLLVSNLLL 0.523 cdc2 YES
Sequence 42 T RCQVTLRDL 0.891 unsp YES
Sequence 61 S IHNLSSEMF 0.718 unsp YES
Sequence 62 S HNLSSEMFS 0.553 unsp YES
Sequence 66 S SEMFSEFDK 0.991 unsp YES
Sequence 72 Y FDKRYTHGR 0.503 INSR YES
Sequence 73 T DKRYTHGRG 0.557 unsp YES
Sequence 90 S CHTSSLATP 0.585 DNAPK YES
Sequence 93 T SSLATPEDK 0.737 unsp YES
Sequence 110 S KDFLSLIVS 0.507 PKA YES
Sequence 118 S SILRSWNEP 0.749 unsp YES
Sequence 124 Y NEPLYHLVT 0.956 unsp YES
Sequence 142 S EAILSKAVE 0.517 CKII YES
Sequence 151 T IEEQTKRLL 0.983 unsp YES
Sequence 163 S ELIVSQVHP 0.623 ATM YES
Sequence 169 T VHTEPKENE 0.541 CKII YES
Sequence 175 Y ENEIYPVWS 0.804 unsp YES
Sequence 191 S ADEESRLSA 0.576 cdc2 YES
Sequence 194 S ESRLSAYYN 0.982 unsp YES
Sequence 207 S LRRDSHKID 0.993 unsp YES

Table 4.

Prediction of phosphorylation sites in hPRL prohormone (positions 1–227) with NetPhos server with a score more than 0.5.

*Score > 0.5 means a statistically significant result.


Modified from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018.

Seq name Position Potential Jury agreement N-Glyc result
Sequence 2 NIKG 0.7530 (9/9) +++ SEQUON ASN-XAA-SER/THR.
Sequence 19 NLLL 0.7151 (9/9) ++
Sequence 59 NLSS 0.7380 (9/9) ++
Sequence 84 NSCH 0.7312 (8/9) +
Sequence 104 NQKD 0.6020 (7/9) +
Sequence 120 NEPL 0.6051 (6/9) +
Sequence 172 NEIY 0.5346 (5/9) +
Sequence 198 NLLH 0.5642 (5/9) +
Sequence 212 NYLK 0.6726 (8/9) +
Sequence 224 NNNC 0.5146 (5/9) +
Sequence 225 NNC- 0.3576 (8/9)
Sequence 226 NC-- 0.3351 (9/9)

Table 5.

Prediction of N-glycosylation sites in hPRL prohormone (positions 1–227) with NetNGlyc 1.0 server with score more than 0.5.

Modified from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018. Note: Asparagines predicted to be N-glycosylated are highlighted in bold font.

#Seq name Source Feature Start End Score Strand Frame Comment
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 25 25 0.134588 . . #POSITIVE
#POSITIVE
#POSITIVE
#POSITIVE
#POSITIVE
#POSITIVE
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 42 42 0.190888 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 54 54 0.194926 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 66 66 0.176466 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 73 73 0.111052 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 80 80 0.613645 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 85 85 0.618483 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 88 88 0.602886 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 89 89 0.717093 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 90 90 0.928857 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 93 93 0.778272 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 128 128 0.181904 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 151 151 0.11243 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 163 163 0.424529 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 169 169 0.122664 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 179 179 0.380532 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 183 183 0.309982 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 191 191 0.1589 . .
SEQUENCE netOGlyc-4.0.0.13 CARBOHYD 194 194 0.249957 . .

Table 6.

Prediction of O-glycosylation sites in hPRL prohormone (position 1–227) with NetOGlyc 4.0 server with score more than 0.5.

Modified from Qian et al. [15], with permission from Frontiers publisher open access article, copyright 2018. Note: The bold value means a statistically significantly positive result.

Advertisement

4. Conclusions

hGH and hPRL are two important hormones in human endocrine systems, which are synthesized in the pituitary gland and secreted into the circulation system. Clarification of hGH proteoforms and hPRL proteoforms in human pituitary is essential step to elucidate their biological functions. Alternative splicing and PTMs are two important factors to cause proteoforms. 2DGE effectively presented 24 hGH proteoforms and 6 hPRL proteoforms with different pI-Mr distributions in 2DGE pattern of pituitary tissue proteome. MS/MS effectively identified their splicing variants and PTMs: (i) 24 hGH proteoforms in pituitary removed their signal peptide, whereas 6 hPRL proteoforms in human pituitary did not remove their signal peptide. (ii) 24 hGH proteoforms in human pituitary are derived from 4 types of alternative splicing variants, whereas 6 hPRL proteoforms do not exist any alternative splicing variants. (iii) PTMs pSer-77, pSer-132, and pSer-176 were identified in some of 24 hGH proteoforms, whereas although no PTMs were identified in hPRL proteoforms with MS/MS. However, phosphorylation, N-glycosylation, and O-glycosylation have been predicted with bioinformatics in hPRL proteoforms. Deamidation was presented in both hGH proteoforms and hPRL proteoforms. Therefore, 2DGE coupled with MS plays crucial roles in detection, identification, and quantification of hormone (hGH and hPRL) proteoforms, which benefits insight into the molecular mechanisms and discovery of effective biomarkers of hormone-related diseases.

Advertisement

Acknowledgments

The authors acknowledge the financial supports from the Xiangya Hospital Funds for Talent Introduction (to X.Z.), the Hunan Provincial “Hundred Talent Plan” program (to X.Z.), the Hunan Provincial Natural Science Foundation of China (Grant No. 14JJ7008 to X.Z.), China “863” Plan Project (Grant No. 2014AA020610-1 to X.Z.), and the National Natural Science Foundation of China (Grant Nos. 81572278 and 81272798 to X.Z.).

Advertisement

Conflict of interest

We declare that we have no financial and personal relationships with other people or organizations.

Advertisement

Author’s contributions

X.Z. conceived the concept, designed the book chapter, wrote and critically revised the book chapter, coordinated and was responsible for the correspondence work and financial support. Z.T. participated in analysis of references and wrote partial manuscript.

Advertisement

Acronyms and abbreviations

BSA

bovine serum albumin

DTT

dithiothreitol

ESI

electrospray ionization

GHRH

growth hormone-releasing hormone

hGH

human growth hormone

hPRL

human prolactin

hPRLRs

hPRL receptors

IEF

isoelectric focusing

IPG

immobilized pH gradient

IGF-1

insulin-like growth factor-1

JAKs

janus-activating tyrosine kinases

LC

liquid chromatography

MALDI

matrix-assisted laser desorption/ionization

Mr

relative mass

MS

mass spectrometry

MS/MS

tandem mass spectrometry

ORFs

open reading frames

PAGE

polyacrylamide gel electrophoresis

pI

isoelectric point

PMF

peptide mass fingerprint

PTM

post-translational modification

PVDF

polyvinylidene fluoride

Q-IT

quadruple-ion trap

SDS-PAGE

sodium dodecyl sulfate-polyacrylamide gel electrophoresis

TOF

time-of-flight

2DGE

two-dimensional gel electrophoresis

References

  1. 1. Zhan X, Giorgianni F, Desiderio DM. Proteomics analysis of growth hormone isoforms in the human pituitary. Proteomics. 2005;5:1228-1241
  2. 2. Brinkman JE, Sharma S. Physiology, Growth Hormone. StatPearls [Internet]. Treasure Island, FL: StatPearls Publishing; 2018
  3. 3. Yoshizato H, Tanaka M, Nakai N, Nakao N, Nakashima K. Growth hormone (GH)-stimulated insulin-like growth factor I gene expression is mediated by a tyrosine phosphorylation pathway depending on C-terminal region of human GH receptor in human GH receptor-expressing Ba/F3 cells. Endocrinology. 2004;145:214-220
  4. 4. Nwosu BU, Lee MM. Evaluation of short and tall stature in children. American Family Physician. 2008;78:597-604
  5. 5. Melmed S. Mechanisms for pituitary tumorigenesis: The plastic pituitary. The Journal of Clinical Investigation. 2003;112:1603-1618
  6. 6. Kato Y, Murakami Y, Sohmiya M, Nishiki M. Regulation of human growth hormone secretion and its disorders. Internal Medicine. 2002;41:7-13
  7. 7. Kohler M, Thomas A, Püschel K, Schänzer W, Thevis M. Identification of human pituitary growth hormone variants by mass spectrometry. Journal of Proteome Research. 2009;8:1071-1076
  8. 8. Pałubska S, Adamiak-Godlewska A, Winkler I, Romanek-Piva K, Rechberger T, Gogacz M. Hyperprolactinaemia–A problem in patients from the reproductive period to the menopause. Menopausal Review. 2017;16:1-7
  9. 9. Tani N, Ikeda T, Watanabe M, Toyomura J, Ohyama A, Ishikawa T. Prolactin selectively transported to cerebrospinal fluid from blood under hypoxic/ischemic conditions. PLoS One. 2018;13:e0198673
  10. 10. Shingo T, Gregg C, Enwere E, Fujikawa H, Hassam R, Geary C, et al. Pregnancy-stimulated neurogenesis in the adult female forebrain mediated by prolactin. Science. 2003;299:117-120
  11. 11. Cabrera-Reyes EA, Limón-Morales O, Rivero-Segura NA, Camacho-Arroyo I, Cerbón M. Prolactin function and putative expression in the brain. Endocrine. 2017;57:199-213
  12. 12. Clevenger CV, Furth PA, Hankinson SE, Schuler LA. The role of prolactin in mammary carcinoma. Endocrine Reviews. 2003;24:1-27
  13. 13. Zhan X, Long Y, Lu M. Exploration of variations in proteome and metabolome for predictive diagnostics and personalized treatment algorithms: Innovative approach and examples for potential clinical application. Journal of Proteomics. 2018;188:30-40
  14. 14. Zhan X, Yang H, Peng F, Li J, Mu Y, Long Y, et al. How many proteins can be identified in a 2DE gel spot within an analysis of a complex human cancer tissue proteome? Electrophoresis. 2018;39:965-980
  15. 15. Qian S, Yang Y, Li N, Cheng T, Wang X, Liu J, et al. Prolactin variants in human pituitaries and pituitary adenomas identified with two-dimensional gel electrophoresis and mass spectrometry. Frontiers in Endocrinology. 2018;9:468
  16. 16. Zhan X, Desiderio DM. Heterogeneity analysis of the human pituitary proteome. Clinical Chemistry. 2003;49:1740-1751
  17. 17. Moreno CS, Evans CO, Zhan X, Okor M, Desiderio DM, Oyesiku NM. Novel molecular signaling and classification of human clinically nonfunctional pituitary adenomas identified by gene expression profiling and proteomic analyses. Cancer Research. 2005;65:10214-10222
  18. 18. Evans CO, Moreno CS, Zhan X, Mccabe MT, Vertino PM, Desiderio DM, et al. Molecular pathogenesis of human prolactinomas identified by gene expression profiling, RT-qPCR, and proteomic analyses. Pituitary. 2008;11:231-245
  19. 19. Wang X, Guo T, Peng F, Long Y, Mu Y, Yang H, et al. Proteomic and functional profiles of a follicle-stimulating hormone positive human nonfunctional pituitary adenoma. Electrophoresis. 2015;36:1289-1304
  20. 20. Guo T, Wang X, Li M, Yang H, Li L, Peng F, et al. Identification of glioblastoma phosphotyrosine-containing proteins with two-dimensional western blotting and tandem mass spectrometry. BioMed Research International. 2015;2015:134050
  21. 21. Zhan X, Desiderio DM. Mass spectrometric identification of in vivo nitrotyrosine sites in the human pituitary tumor proteome. Methods in Molecular Biology. 2009;566:137-163
  22. 22. Zhan X, Desiderio DM. A reference map of a human pituitary adenoma proteome. Proteomics. 2003;3:699-713
  23. 23. Peng F, Li J, Guo T, Yang H, Li M, Sang S, et al. Nitroproteins in human astrocytomas discovered by gel electrophoresis and tandem mass spectrometry. Journal of the American Society for Mass Spectrometry. 2015;26:2062-2076
  24. 24. Blom N, Gammeltoft S, Brunak S. Sequence and structure-based prediction of eukaryotic protein phosphorylation sites. Journal of Molecular Biology. 1999;294:1351-1362
  25. 25. Blom N, Sicheritz-Ponten T, Gupta R, Gammeltoft S, Brunak S. Prediction of post-translational glycosylation and phosphorylation of proteins from the amino acid sequence. Proteomics. 2004;4:1633-1649
  26. 26. Gupta R, Brunak S. Prediction of glycosylation across the human proteome and the correlation to protein function. Pacific Symposium on Biocomputing. 2002;7:310-322
  27. 27. Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, et al. Precision mapping of the human O-GalNAc glycoproteome through Simple Cell technology. The EMBO Journal. 2013;32:1478-1488

Written By

Xianquan Zhan and Tian Zhou

Submitted: 08 September 2018 Reviewed: 14 November 2018 Published: 19 December 2018